PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100236590001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family ZF-HD
Protein Properties Length: 195aa    MW: 22709.6 Da    PI: 9.4402
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100236590001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer74.91.1e-231431760
                   ZF-HD_dimer 17 lGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                                  +Ggh+vDGCgEfmps g++gt++al+CaAC+CHRnFHRre e +
  Ote100236590001|100236590001  1 MGGHVVDGCGEFMPS-GDDGTPQALRCAACDCHRNFHRREIEGQ 43
                                  7*************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015664.4E-22140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-15143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-21140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152319.388139IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.35E-18120189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27121189IPR009057Homeodomain-like
PROSITE profilePS500718.633126190IPR001356Homeobox domain
TIGRFAMsTIGR015659.0E-28128185IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MGGHVVDGCG EFMPSGDDGT PQALRCAACD CHRNFHRREI EGQQHPFHSY AFXXXXXXXX  60
XXXXXXXXXX XXXXNRQTPA HHRGFAAPPT MVSXXXXXXX XXXXXXXDLN IFQSSDAAXX  120
XXXXXXSKKR FRTKFRQDQK ERMHEFATKL GWRLQKQDEQ EVQEFCSEIG VKRQSFKIWM  180
HNNKQAIKKR SSSEV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-201271861675ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099626.15e-67PREDICTED: zinc-finger homeodomain protein 6
TrEMBLA0A022RJ013e-59A0A022RJ01_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128